DNM3B_MOUSE O88509
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88509
Recommended name：DNA (cytosine-5)-methyltransferase 3B (Dnmt3b)
EC number：EC 2.1.1.37
Alternative names：(DNA methyltransferase MmuIIIB) (DNA MTase MmuIIIB) (M.MmuIIIB)
Cleaved into：
GeneID：13436
Gene names (primary )：Dnmt3b
Gene names (synonym )：
Gene names (ORF )：
Length：859
Mass：97228
Sequence：MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRRRRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDSTEYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPMLEWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVMASKNDKLELQDCLEFSRTAKLKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELERIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Tissue specificity：
Induction：
Developmental stage：Expressed in almost all blastocysts at 3.0 dpc. Preferentially expressed in the trophectoderm (TE) in 3.5 dpc and polar TE in 4.0 dpc blastocysts. In 4.5 dpc embryos, expressed in the polar TE and some inner cell mass (ICM) embryonic lineage cells. In post-implantation embryo at 5.5 dpc, expressed in the epiblast (embryonic lineage) derived from the ICM. Highly expressed, at 7.5 dpc, in the embryonic ectoderm, neural ectoderm, and chorionic ectoderm; a weak expression is also detected in mesodermal and endodermal cells. At later stages, the expression is detected predominantly in the forebrain and eyes but weakly throughout the embryo. {ECO:0000269|PubMed:10555141, ECO:0000269|PubMed:18814855}.
Protein families：Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family