LHX1_MOUSE P63006
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63006
Recommended name：LIM/homeobox protein Lhx1
EC number：
Alternative names：(LIM homeobox protein 1) (Homeobox protein Lim-1)
Cleaved into：
GeneID：16869
Gene names (primary )：Lhx1
Gene names (synonym )：Lim-1 Lim1
Gene names (ORF )：
Length：406
Mass：44780
Sequence：MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLDHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
Tissue specificity：In mid to late stage embryos, expressed in a restricted region of mesoderm in the primitive streak. At 7.5 days, expressed in a horseshoe shape at the periphery of the node, as well as along both sides of the adjacent notochord. Also present in presumptive lateral and intermediate mesoderm. Later, expression become progressively restricted to intermediate mesoderm, and the developing excretory system including the pronephric region, mesonephros, nephric duct and metanephros. In the metanephros, strongly expressed in renal vesicles and S-shaped and coma-shaped bodies, as well as in the ureteric bud and its derivatives. Also expressed in the dorsal root ganglia. By stage 10.5, also expressed in regions of the central nervous system in the telencephalon through to the spinal cord. In adults, expressed in the cerebellum/medulla and kidney, and at very low levels in the cerebrum. {ECO:0000269|PubMed:7904966, ECO:0000269|PubMed:7909459, ECO:0000269|PubMed:8793615}.
Induction：
Developmental stage：Expressed in both embryos and adults. {ECO:0000269|PubMed:7909459}.
Protein families：