ANR54_MOUSE Q91WK7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WK7
Recommended name：Ankyrin repeat domain-containing protein 54
EC number：
Alternative names：(Lyn-interacting ankyrin repeat protein)
Cleaved into：
GeneID：223690
Gene names (primary )：Ankrd54
Gene names (synonym )：Liar
Gene names (ORF )：
Length：299
Mass：32486
Sequence：MAATGGGADDESRSGRSSSDGECAVAPEPLAEAGGLVSFADFGVSLGSGAGLPGRSVGRAQSSLRYLQVLWQQDVEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQQDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHSQCLEAVRLEVKQIIHMLREYLERLGRHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR
Tissue specificity：Expressed in a variety of hemopoietic cell lines and tissue with high levels in testis. Highly expressed in ciliated cells. {ECO:0000269|PubMed:17971504, ECO:0000269|PubMed:19064729}.
Induction：
Developmental stage：Expressed in brachial arches, maxillary process, fore and hind limb buds and in the developing gastrointestinal tract of day 10 embryos.
Protein families：