EAF2_MOUSE Q91ZD6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZD6
Recommended name:ELL-associated factor 2
EC number:
Alternative names:(Ehrlich S-II transcriptional activator factor) (Testosterone-regulated apoptosis inducer and tumor suppressor protein)
Cleaved into:
GeneID:106389
Gene names (primary ):Eaf2
Gene names (synonym ):Festa Traits
Gene names (ORF ):
Length:262
Mass:29187
Sequence:MSGPAGLAYLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSCEGNLEVGKGEQVTITLPNIEGSTPPVTVFKGSKRPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSRIQYRLEQQQQQMWNLPRTSNLVQHSPSEEKMSPTSLMDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDDDQFSPLGPRKYSSEHPSMSAGPQYRTSEADATCHRLQDHSTLLMSTLRSDLQLSESESDSED
Tissue specificity:Isoform 1 is expressed in ovary, uterus, mammary glands, brain, spleen, liver, lung, thymus, kidney, skeletal muscle, skin and testis. Isoform 2 is expressed in kidney. {ECO:0000269|PubMed:12761297, ECO:0000269|PubMed:14517999}.
Induction:
Developmental stage:Expressed in brain and spinal cord at 10 dpc. Expressed in brain, spinal cord, cranial and spinal ganglia, lens, retina, cochlea, olfactory epithelium and pituitary at 12 dpc. Expressed in intestine, bladder endothelium, retinal ganglion cells, nephrons, bronchial epithelium, secretory epithelium of submandibular glands, tubular epithelium of the epididymis, ectodermal invaginations of mammary buds and vibrissae follicles, incisors and molars at 15 dpc. {ECO:0000269|PubMed:14517999}.
Protein families:EAF family