RING1_MOUSE O35730
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35730
Recommended name：E3 ubiquitin-protein ligase RING1
EC number：EC 2.3.2.27
Alternative names：(Polycomb complex protein RING1) (RING finger protein 1) (RING-type E3 ubiquitin transferase RING1) (Transcription repressor Ring1A)
Cleaved into：
GeneID：19763
Gene names (primary )：Ring1
Gene names (synonym )：Ring1A Rnf1
Gene names (ORF )：
Length：406
Mass：42631
Sequence：MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTATMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGAGAGASSVGTGGGAAGGACGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQETTEPGGPGGGASDTGGPDGGGGERGVAGGGEGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
Tissue specificity：
Induction：
Developmental stage：Expressed in cells of the central nervous system (CNS) from 8.5 to 11.5 dpc. Expressed in the hindbrain (in the rhombomere boundaries) at 10.5 dpc. Expressed in CNS (ventricular zone and spinal cord), peripheral nervous system (PNS, sensory cranial and spinal ganglia), olfactory and tongue epithelia at 13.5 dpc. Expressed in CNS, thymus, various epithelial cell types including the olfactory, tooth and tongue epithelia at 15.5 dpc. {ECO:0000269|PubMed:9312051}.
Protein families：