PRKX_MOUSE Q922R0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q922R0
Recommended name:cAMP-dependent protein kinase catalytic subunit PRKX
EC number:EC 2.7.11.1
Alternative names:(PrKX) (Protein kinase X) (Protein kinase X-linked) (Serine/threonine-protein kinase PRKX) (PKA-related protein kinase)
Cleaved into:
GeneID:19108
Gene names (primary ):Prkx
Gene names (synonym ):Pkare
Gene names (ORF ):
Length:355
Mass:40467
Sequence:MEPPAGAAATVKDPDHDPVKTKVSAPAADPKPRTSSQKAGHSLQDWDTIATVGTGTFGRVNLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKLSGDGDISNFETYPESELDKTPSVSDKDLETFKNF
Tissue specificity:Widely expressed. {ECO:0000269|PubMed:10729225}.
Induction:
Developmental stage:Expressed in central nervous system and heart tissues in early development stages and in most organs at later stages (at protein level). Detected in embryos from 9 dpc onward with higher expression in differentiating neuronal tissues at 11.5 dpc. {ECO:0000269|PubMed:10729225, ECO:0000269|PubMed:15879576}.
Protein families:Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily