GREM2_MOUSE O88273
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88273
Recommended name:Gremlin-2
EC number:
Alternative names:(Cysteine knot superfamily 1, BMP antagonist 2) (Protein related to DAN and cerberus) (PRDC)
Cleaved into:
GeneID:23893
Gene names (primary ):Grem2
Gene names (synonym ):Cktsf1b2 Prdc
Gene names (ORF ):
Length:168
Mass:19334
Sequence:MFWKLSLTLLLVAVLVKVAETRKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ
Tissue specificity:Highly expressed in the ovary, followed by brain, spleen, colon, kidney and uterus. In ovary expressed in granulosa cells of selective early antral follicles. {ECO:0000269|PubMed:15039429}.
Induction:Up-regulated by gonadotropin treatment. {ECO:0000269|PubMed:15039429}.
Developmental stage:Expressed in commissural neurons in the developing spinal cord (PubMed:9639362). Expressed during the development of teeth and hair follicles (PubMed:26416033). {ECO:0000269|PubMed:26416033, ECO:0000269|PubMed:9639362}.
Protein families:DAN family