LGI2_MOUSE   Q8K4Z0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K4Z0

Recommended name:Leucine-rich repeat LGI family member 2

EC number:

Alternative names:(Leucine-rich glioma-inactivated protein 2)

Cleaved into:

GeneID:246316

Gene names  (primary ):Lgi2

Gene names  (synonym ):Kiaa1916

Gene names  (ORF ):

Length:550

Mass:63006

Sequence:MALWRGGGALGLLLLSAACLIPPSAQVRRLARCPATCSCTKESIICVGSSWVPRIVPGDISSLSLVNGTFLEIKDRMFSHLPSLQLLLLNSNSFTVIRDDAFAGLFHLEYLFIEGNKIETISRNAFRGLRDLTHLDLRGNKFECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNEVTSFDYECTTTGPQTDEAKQRGWQLELSLGFCELIFVFQHPLSDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEWDHIEMNFRSYDNITGQSIVGCKAILIDDQVFVVVAQLFGGSHIYKYDESWTKFVKFQDIEVSRISKPNDIELFEIDDETFFIIADSSKAGLSTVYKWNSKGFYSYQSLHEWFRDTDAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIPNMEDVLAVKSFRMQNTLYLSLTRFIGDSRVMRWNSKQFVEVQALPSRGAMTLQPFSFKDNHYLALGSDYTFSQIYQWDKEKQQFKKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKTKIFEHIIVDLSL

Tissue specificity:Brain. {ECO:0000269|PubMed:19833108}.

Induction:

Developmental stage:Expressed in developing parvalbumin-positive basket cells. {ECO:0000269|PubMed:30679375}.

Protein families:


   💬 WhatsApp