DLX2_MOUSE P40764
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P40764
Recommended name:Homeobox protein DLX-2
EC number:
Alternative names:(Homeobox protein TES-1)
Cleaved into:
GeneID:13392
Gene names (primary ):Dlx2
Gene names (synonym ):Tes-1 Tes1
Gene names (ORF ):
Length:332
Mass:34746
Sequence:MTGVFDSLVADMHSTQITASSTYHQHQQPPSGAGAGPGGNSNSSSSNSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPTEQHPGASASPPCASPPVSAPASWDFGAPQRMAGGGPGSGGGGAGSSGSSPSSAASAFLGNYPWYHQASGSASHLQATAPLLHPSQTPQAHHHHHHHHHAGGGAPVSAGTIF
Tissue specificity:Expressed only in neural and other ectodermal structures of the head: the brain, the vomeronasal organ, and the preameloblasts of the teeth (PubMed:8098616). Primarily expressed in the germinal cells of the ventral forebrain in the midgestational embryo, and in both dorsal and ventral ventricular zones in late embryogenesis and early postnatal life (PubMed:8098616). Expressed in the inner nuclear layer of the retina (PubMed:21875655). {ECO:0000269|PubMed:21875655, ECO:0000269|PubMed:8098616}.
Induction:
Developmental stage:Expressed in developing retinal progenitor cells at 12 dpc (PubMed:21875655). Developmentally regulated (PubMed:1678612, PubMed:1687503). {ECO:0000269|PubMed:1678612, ECO:0000269|PubMed:1687503, ECO:0000269|PubMed:21875655}.
Protein families:Distal-less homeobox family