PERP_MOUSE Q9JK95
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK95
Recommended name：p53 apoptosis effector related to PMP-22
EC number：
Alternative names：(Keratinocyte-associated protein 1) (KCP-1)
Cleaved into：
GeneID：64058
Gene names (primary )：Perp
Gene names (synonym )：Krtcap1
Gene names (ORF )：
Length：193
Mass：21567
Sequence：MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGSYDDGCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQMLVFLRVIGGLLALAAIFQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDLLGAAKPRYFYPPA
Tissue specificity：Expressed in the stratified squamous skin epithelium of the skin and the tongue, but not in simple epithelia (at protein level). Expressed in apoptotic cells. {ECO:0000269|PubMed:10733530, ECO:0000269|PubMed:15797384}.
Induction：Up-regulated by UV irradiation, doxorubicin (DOX) and TP53 in embryo fibroblasts. {ECO:0000269|PubMed:10733530}.
Developmental stage：Expressed in developing skin during and after the stratification process from 9.5 to 15.5 dpc (at protein level). Expressed in ectoderm of the developing branchial arches and limb buds from the 9.5 to 10.5 dpc. Expressed in epithelia of the oral mucosa and skin from the 16.5 to 18.5 dpc. {ECO:0000269|PubMed:15797384}.
Protein families：TMEM47 family