PO4F3_MOUSE Q63955
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63955
Recommended name:POU domain, class 4, transcription factor 3
EC number:
Alternative names:(Brain-specific homeobox/POU domain protein 3C) (Brain-3C) (Brn-3C) (Brn-3.1)
Cleaved into:
GeneID:18998
Gene names (primary ):Pou4f3
Gene names (synonym ):Brn-3.1 Brn-3c Brn3c
Gene names (ORF ):
Length:338
Mass:37016
Sequence:MMAMNAKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSPTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHAVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Tissue specificity:Brain.
Induction:
Developmental stage:Expressed in developing spinal cord from 13 dpc to postanal day 1, not expressed in adults (PubMed:8290353). Expressed by few neurons of dorsal root ganglion from, at least, 10.5 dpc to 15.5 dpc (PubMed:22326227). {ECO:0000269|PubMed:22326227, ECO:0000269|PubMed:8290353}.
Protein families:POU transcription factor family, Class-4 subfamily