TX19A_MOUSE   Q99MV2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99MV2

Recommended name:Testis-expressed protein 19.1

EC number:

Alternative names:(mTex19.1) (Testis-expressed protein 19A)

Cleaved into:

GeneID:73679

Gene names  (primary ):Tex19.1

Gene names  (synonym ):Tex19 Tex19a

Gene names  (ORF ):

Length:351

Mass:40401

Sequence:MCPPVSVRHGARGMSCLYEAWLYHLVHGEQTKICFACFKAAFLLNKLYLEMGDWQEEEEEEEEEDADLLEYLSESESESEQEPGPEQDAWRGLGSLYVPQSVSEGSGVLLPTPVWTQGILFSIFVPTELFPQEAVPLDLGPEDAEWTQALPWRLDGLFPCSHQLIPPLTWWDIFDVMPSPGQPVLLELRCHWPLDQTVAQSWLQDQKFVLLLDSVQSRCHLLSMRVRWVVRTQVQHWQVLLDPGEMWVAHFRKEVGQHGLYHQSLNPWRLSILTASELGMELLPATCYLWNKGFWVGSFLPWHINMPETWSWEPGERLFITDATICGTDYHLAQSFLDSHPTPHPLLTLTP

Tissue specificity:Expressed in testis, placenta and ovary. Expressed in pluripotent stem cells. In testis, expression is highest in mitotic spermatogonia, decreases as spermatocytes progress through meiosis, and is present at low levels in round spermatids (at protein level). {ECO:0000269|PubMed:18096721, ECO:0000269|PubMed:18802469, ECO:0000269|PubMed:22447323, ECO:0000269|PubMed:28254886}.

Induction:Expression is down-regulated by DAZL protein, which binds to 3'UTR of Tex19.1 mRNAs and probably represses its translation. {ECO:0000269|PubMed:19247806}.

Developmental stage:Expressed in early embryo and is later limited to the germ line. Expressed in the ectoderm and then in primordial germ cells (PGCs). Expressed in testis from 13.5 dpc to adulthood in gonocytes and spermatocytes. Also present in the developing and adult ovary as well as in the placenta and its precursor tissue, the ectoplacental cone. {ECO:0000269|PubMed:18096721}.

Protein families:


   💬 WhatsApp