DGCR6_MOUSE   O35347


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35347

Recommended name:Protein DGCR6

EC number:

Alternative names:(DiGeorge syndrome critical region 6 homolog)

Cleaved into:

GeneID:13353

Gene names  (primary ):Dgcr6

Gene names  (synonym ):

Gene names  (ORF ):

Length:198

Mass:22837

Sequence:MDRYAAAGDEAADRARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQTLRQKHLEAQQSCRPHNLPVLQAAQQRELEAMEHRIREEQQAMDRKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELTLQMNLLELIRKLQQRSCQVGKAAL

Tissue specificity:Expressed in all the examined tissues with highest expression in testis.

Induction:

Developmental stage:Expressed in early embryogenesis. Found in the peripheral and central nervous systems.

Protein families:Gonadal family


   💬 WhatsApp