BSH_MOUSE Q810B3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q810B3
Recommended name：Brain-specific homeobox protein homolog
EC number：
Alternative names：
Cleaved into：
GeneID：244813
Gene names (primary )：Bsx
Gene names (synonym )：
Gene names (ORF )：
Length：232
Mass：25862
Sequence：MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLTPHAHHPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVLTEPEDEVDIGDEGELSSGPHVL
Tissue specificity：Expressed in brain. In brain, it is restricted to a few specific developing brain structures such as pineal gland, telencephalic septum, hypothalamic pre-mammillary body and arcuate nucleus. {ECO:0000269|PubMed:14678827}.
Induction：
Developmental stage：Expressed in early embryonic stages of epiphysis development from 9.5 dpc onwards. {ECO:0000269|PubMed:14678827}.
Protein families：Distal-less homeobox family