MCAF2_MOUSE   Q3UL97


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UL97

Recommended name:Activating transcription factor 7-interacting protein 2

EC number:

Alternative names:(MBD1-containing chromatin-associated factor 2) (Protein similar to MCAF2)

Cleaved into:

GeneID:75329

Gene names  (primary ):Atf7ip2

Gene names  (synonym ):Mcaf2 Psm2

Gene names  (ORF ):

Length:452

Mass:50975

Sequence:MESPDRKRQKVLKAKKTMPTSYQKQLEILNKSTNVEAPKTTVGTNIPNGHNQKMFSKNKENVKVMKVSEQINENACGALERHTALLEQVKHWIRQEICMINCNLFDKKLNELNERIGKTQCKSRHEAIAGELFVKIRRLQKRIKTVLSSQRNCLEPNTLPSNTVCKVTDSEAMNLNVTQKSVKSRSKRISSVNHTPLNSSEKAGRKTNLPSTCVEFASESNTDDVMLISVKNSNLTTSITSEQTEIRKNTSRNLSNSPNSMIKVGPVEKKFDFVIDLTREGPSNYSIESPSFTLKSTSKAVLRSKEIIPVAENGNEGFGSFEHLPPLPEPPAPLPEMADKIKDTLPPQKPELKVKWVLRPTSIALTWNIPKVNPNCAPVESYHLFLYYENSDHLTWKKIAEIKALPLPMACTLSQNLASTKYYFAVQSKDIFGRYGPFCNIKSIPRFSENLT

Tissue specificity:Expressed in testis. {ECO:0000269|PubMed:16850184}.

Induction:

Developmental stage:Expressed in early mouse embryo, especially in the embryonic gonad from 11.5 dpc. Continuously expressed from newborn testis to adult. {ECO:0000269|PubMed:16850184}.

Protein families:MCAF family


   💬 WhatsApp