GATD1_MOUSE Q920S3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920S3
Recommended name：GATA zinc finger domain-containing protein 1
EC number：
Alternative names：(Ocular development-associated gene protein)
Cleaved into：
GeneID：67210
Gene names (primary )：Gatad1
Gene names (synonym )：Odag
Gene names (ORF )：
Length：266
Mass：28535
Sequence：MPLGLKPTCSMCKTTSSSMWKKSPQGEILCHHCTGRGGGGAGVAGGTGGGGGGGGGFGTTTFATTSAGPSQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIVTAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLASPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKETVANHL
Tissue specificity：Expressed in the eye (lens, ciliary body, retina, sclera and conjunctiva) at postnatal day 2 and 10. Not detected anywhere at postnatal day 14. {ECO:0000269|PubMed:12062807}.
Induction：
Developmental stage：Expressed in embryo at 13 dpc onwards. Expressed in embryonic heart at all stages of development. {ECO:0000269|PubMed:12062807, ECO:0000269|PubMed:21965549}.
Protein families：