AGR2_MOUSE O88312
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88312
Recommended name：Anterior gradient protein 2 homolog
EC number：
Alternative names：(AG-2) (mAG-2) (Protein Gob-4) (Secreted cement gland protein XAG-2 homolog)
Cleaved into：
GeneID：23795
Gene names (primary )：Agr2
Gene names (synonym )：Gob4
Gene names (ORF )：
Length：175
Mass：19920
Sequence：MEKFSVSAILLLVAISGTLAKDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
Tissue specificity：Expressed in lung, skeletal muscle, testis, liver, stomach, colon, small intestine, the goblet cells of the intestine and the mucuous neck cells of the stomach. {ECO:0000269|PubMed:10095068, ECO:0000269|PubMed:9790916}.
Induction：
Developmental stage：Expressed in embryo at 15 dpc onwards.
Protein families：AGR family