OVCA2_MOUSE Q9D7E3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D7E3
Recommended name：Esterase OVCA2
EC number：EC 3.1.2.-
Alternative names：(Ovarian cancer-associated gene 2 protein homolog)
Cleaved into：
GeneID：246257
Gene names (primary )：Ovca2
Gene names (synonym )：
Gene names (ORF )：
Length：225
Mass：24246
Sequence：MAARQTLRVLCLAGFRQSERGFREKTGALRKTLRGRAELVCLSGPHPVPEAAAPEGSCPDSGPCSPEEQPRGWWFSEEEADVFSALEESTVCRGLQEALETVARALDTLGPFDGLLGFSQGAALAAYVCALGQAGDPRFPLPRFIILVSGFCPRGLKEPILQSPMSLPSLHVFGDTDRVIPSQESMQLASRFLGAVTLTHSGGHFIPAAASQRQAYLKFLDQFAE
Tissue specificity：Strongly expressed in kidney and liver. Moderately expressed in brain, skin and testis. Weakly expressed in heart, lung, small intestine, spleen, stomach and thymus. {ECO:0000269|PubMed:11527402}.
Induction：
Developmental stage：Expressed in embryonic stem (ES) cells. {ECO:0000269|PubMed:11527402}.
Protein families：LovG family