TISB_MOUSE   P23950


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P23950

Recommended name:mRNA decay activator protein ZFP36L1

EC number:

Alternative names:(Butyrate response factor 1) (TPA-induced sequence 11b) (Zinc finger protein 36, C3H1 type-like 1) (ZFP36-like 1)

Cleaved into:

GeneID:12192

Gene names  (primary ):Zfp36l1

Gene names  (synonym ):Brf1 Tis11b

Gene names  (ORF ):

Length:338

Mass:36385

Sequence:MTTTLVSATIFDLSEVLCKGNKMLNYSTPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPSLSSRDSRFRDRSFSEGGERLLPTQKQPGSGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGGRDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDHEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

Tissue specificity:Expressed in preadipocytes and adipocytes (PubMed:22701344). Expressed in the proximal and distal tubules in the renal cortex (at protein level) (PubMed:24700863). Expressed in ovary, heart, kidney, lung, spleen and thymus (PubMed:15226444). Weakly expressed in brain, liver and testis (PubMed:15226444). Expressed in osteoblasts (PubMed:15465005). Expressed in embryonic stem cells (ESCs) (PubMed:24733888). Expressed through B lymphocyte development (PubMed:27102483). {ECO:0000269|PubMed:15226444, ECO:0000269|PubMed:15465005, ECO:0000269|PubMed:22701344, ECO:0000269|PubMed:24700863, ECO:0000269|PubMed:24733888, ECO:0000269|PubMed:27102483}.

Induction:Up-regulated during myogenic differentiation in a p38 MAPK-dependent manner (PubMed:17889962). Up-regulated in response to fibroblast growth factor FGF4 in embryonic stem cells (ESCs) in a p38 MAPK-dependent manner (PubMed:24733888). Up-regulated during high sodium diet-fed in the renal tubules (PubMed:24700863). Up-regulated upon hypertonic stress condition with raffinose (at protein level) (PubMed:24700863). Up-regulated by parathyroid hormone (PTH) in calvarial osteoblasts (PubMed:15465005). Up-regulated in response to adrenocorticotropic hormone (ACTH) (PubMed:19179481). Up-regulated in response to cAMP (PubMed:19179481). Down-regulated by bone morphogenetic protein BMP2 treatment in calvarial osteoblasts (PubMed:15465005). Down-regulated during the conversion from quiescence to activated satellite cells upon muscle injury (PubMed:23046558, PubMed:25815583). {ECO:0000269|PubMed:15465005, ECO:0000269|PubMed:17889962, ECO:0000269|PubMed:19179481, ECO:0000269|PubMed:23046558, ECO:0000269|PubMed:24700863, ECO:0000269|PubMed:24733888, ECO:0000269|PubMed:25815583}.

Developmental stage:Expressed in embryos at 8 dpc, onward (PubMed:15226444). Expressed in the allantois and throughout the neuroectoderm and paraxial mesoderm at 8 dpc (PubMed:15226444). Expressed in the chorion and blood vessels at 8.5 dpc (PubMed:17013884). Expressed in the neural tube, paraxial mesoderm, heart, brain, otic vesicle and yolk sac at 9.5 dpc (PubMed:17013884). Expressed in embryonic stem cells (ESC) (PubMed:15226444). {ECO:0000269|PubMed:15226444, ECO:0000269|PubMed:17013884}.

Protein families:


   💬 WhatsApp