ALX3_MOUSE O70137
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70137
Recommended name：Homeobox protein aristaless-like 3
EC number：
Alternative names：(Proline-rich transcription factor ALX3)
Cleaved into：
GeneID：11694
Gene names (primary )：Alx3
Gene names (synonym )：
Gene names (ORF )：
Length：343
Mass：36851
Sequence：MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSRFPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSAEAEEKASKAASFPQLPVDCRGGPRDGPSNVQASPGPCLASLSVPLSPGLPDSMELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKMQEGRNPFTTAYDISVLPRTDSHPQLQNSLWPSPGSGSPGGPCLMSPEGIPSPCMSPYSHSHGNVAGFMGVPASPAAHPGIYSIHGFPPALGGHSFEPSPDGDYKSPSLVSLRMKPKEPPGLLNWTT
Tissue specificity：Predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm. Prominent expression in frontonasal head mesenchyme and in the first and second pharyngeal arches and some of their derivatives. High expression is also seen in the tail and in many derivatives of the lateral plate mesoderm including the limbs, the body wall, and the genital tubercle.
Induction：
Developmental stage：Expressed in embryos from 8 days of gestation onward.
Protein families：Paired homeobox family