CCNO_MOUSE   P0C242


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C242

Recommended name:Cyclin-O

EC number:

Alternative names:

Cleaved into:

GeneID:218630

Gene names  (primary ):Ccno

Gene names  (synonym ):

Gene names  (ORF ):

Length:352

Mass:38822

Sequence:MVTPCPASPGSPAAGAGRRDSHQNLRAPVKKSRRPCLRRKKPLRPLNACSLPGDSGVCDLFESPSSSSDGADSPAVSAARDCSSLLNPAQPLTALDLQTFREYGQSCYDFRKAQENLFHPRESLARQPQVTAESRCKLLSWLLQVHRQFGLSFESLCLTVNTLDRFLLTTPVAADCFQLLGVTCLLIACKQVEVHPPRLKQLLALCGGAFSRQQLCNLECIVLHKLHFSLGAPTINFFLEHFTQWRMEAGQAEVTEALEAQTLARGVAELSLTDYAFTTYTPSLMAICCLALADGLLQHQHEMDLRLGEHPEATLQDCLGKLQTLVSINSSSLPRILPPQIWERCSLPQSWQ

Tissue specificity:Present in respiratory cells (at protein level). Expressed in multiciliated tissue in brain and fallopian tube (at protein level) (PubMed:26777464). Highly expressed in oocytes. {ECO:0000269|PubMed:19609756, ECO:0000269|PubMed:24747639, ECO:0000269|PubMed:26777464}.

Induction:

Developmental stage:Expressed in ependymal cells of the embryonic brain, but almost absent in the adult brain. {ECO:0000269|PubMed:26777464}.

Protein families:Cyclin family


   💬 WhatsApp