NOX3_MOUSE   Q672J9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q672J9

Recommended name:NADPH oxidase 3

EC number:EC 1.6.3.-

Alternative names:

Cleaved into:

GeneID:224480

Gene names  (primary ):Nox3

Gene names  (synonym ):

Gene names  (ORF ):

Length:568

Mass:64495

Sequence:MPVCWILNESGSFVVALLWLAVNAYLFIDTFFWYTEEEAFFYTRVILGSALAWARASAVCLNFNCMLILLPVSRNFISLVRGTSVCCRGPWRRQLDKNLNFHKLVAYGIAVNSVIHIVAHLFNLERYHLGQAKDAEGLLAALSKLGDAPNESYLNPVRTFDMGTTTELLMTVSGITGLGISLALVFIMTSSTEFIRRSSYELFWYTHHIFVFFFISLAIHGGGRIIRGQTPESLRLHNVTYCRDHYAEWQAAALCPVPQFSGKEPSAWKWALGPVVLYACERIIRFWRSHQEVVITKVVSHPSAVLELHMKKRDFKMAPGQYIFIQCPSVSPLEWHPFTLTSAPQEDFFSVHIRASGDWTEALLKAFRVEGQAPSELCSMPRLAVDGPFGGSLADVFHYPVSVCIATGIGVTPFASLLKSVWYKCCESQSLPELSKVYFYWICRDAGAFEWFADLLLSLETRMSEQGKAHLLSYHIYLTGWDENQAIHIALHWDESLDVITGLKQKAFYGRPNWNDEFKQIAYNHPSSSIGVFFCGSKAMSKTLQKMCRLYSSVDPRGVHFYYNKENF

Tissue specificity:Specifically expressed in inner ear by the spiral glanglion neurons, the vestibular system and the sensory epithelial cell layer of the saccule. Weakly expressed in skull and brain. {ECO:0000269|PubMed:15326186}.

Induction:

Developmental stage:Expressed in fetal kidney. {ECO:0000269|PubMed:15326186}.

Protein families:


   💬 WhatsApp