RFPLA_MOUSE Q8VH31
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VH31
Recommended name：Ret finger protein-like 4A
EC number：
Alternative names：
Cleaved into：
GeneID：192658
Gene names (primary )：Rfpl4a
Gene names (synonym )：Rfpl4
Gene names (ORF )：
Length：287
Mass：32358
Sequence：MAHLFKEKSNCYFCFRCLESPVYLNCGYICCLKCLDSLEKSPEGDGVLCPTCSVVSLKEDIIHAKQLGALVTKIKNLEPQLNFILTMDQGMKIFQVTMTLDVDTAQNHLIISDDLLSVYYTPQKQARKKCAERFHPSPCVLGSSRFTSGRHYWEVVVGTSKEWDIGICKESINRKKAIHLSEKNGFWTVGVRAKKVYSASTDPLTVLRVNPRLRRVGIFLDMLEKSVSFWDLSDGSHIYTFLEIPDTDPFRPFFSPASSYPDGDQEQVLSICPVTNPGIFGIPVNPQ
Tissue specificity：Expressed in the ovaries and oocytes (at protein level) (PubMed:12525704, PubMed:11850190). Expression restricted to gonads. In testis, present at later stages of spermatogeneis and abundant in elongating spermatids. {ECO:0000269|PubMed:11850190, ECO:0000269|PubMed:12525704}.
Induction：
Developmental stage：Expressed in growing oocytes and early embryos. {ECO:0000269|PubMed:12525704}.
Protein families：