LHPL5_MOUSE Q4KL25
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4KL25
Recommended name：LHFPL tetraspan subfamily member 5 protein
EC number：
Alternative names：(Lipoma HMGIC fusion partner-like 5 protein) (Tetraspan membrane protein of hair cell stereocilia)
Cleaved into：
GeneID：328789
Gene names (primary )：Lhfpl5
Gene names (synonym )：Tmhs
Gene names (ORF )：
Length：219
Mass：24186
Sequence：MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVSTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALAMFLIIGSIICFSLFFVCNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFMLAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGNEEV
Tissue specificity：Brain, inner ear hair cells and vestibular neuroepithelia of the inner ear (PubMed:16459341, PubMed:23217710, PubMed:15905332). In inner ear, expressed in stereocilia in a punctate pattern and at the tip-link region (at protein level) (PubMed:16459341, PubMed:23217710, PubMed:15905332). Strongly expressed in brain (PubMed:26964900). Weakly expressed in heart, testis and intestine (PubMed:26964900). {ECO:0000269|PubMed:15905332, ECO:0000269|PubMed:16459341, ECO:0000269|PubMed:23217710, ECO:0000269|PubMed:26964900}.
Induction：
Developmental stage：Expressed in inner ear hair cells at 16.5 dpc. Expressed postnatally in inner and outer hair cells of the cochlear, as well as in vestibular hair cells. At the cochlear apex, levels are low at P1 and increased thereafter. After P7, hardly detectable at the protein level, while mRNA levels remains high in adult hair cells. {ECO:0000269|PubMed:16459341, ECO:0000269|PubMed:23217710}.
Protein families：LHFP family