FBX25_MOUSE Q9D2Y6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D2Y6
Recommended name：F-box only protein 25
EC number：
Alternative names：
Cleaved into：
GeneID：66822
Gene names (primary )：Fbxo25
Gene names (synonym )：Fbx25
Gene names (ORF )：
Length：357
Mass：41826
Sequence：MPFLGQDWRSPGWSWIKTEDGWKRCDPCSHELRSEDSQYTINHSIILNSGEEEIFNNECEYAAKKRKKEHFGNDTAAHSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKGLLQDLSSTLGILVRGVGKSVLVGNINIWICRLETVLSWQQQLQNLQVTKQVNTGLTLSDLPLHMLNNILYRFSDGWDIVTLGQVTPTLYMLSEDRRLWKRLCQYHFAEQQFCRHLILSEKGHIEWKLMYFTLQKYYPTKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPEHFIDLFKF
Tissue specificity：Expressed in all tissues tested, except striated muscle (at protein level). Expressed predominantly in the cerebral cortex, the hippocampus and the Purkinje cell layer of the brain. Intestine and kidney show also significant levels. {ECO:0000269|PubMed:16278047, ECO:0000269|PubMed:16714087, ECO:0000269|PubMed:18287534}.
Induction：
Developmental stage：Expressed in neuronal tissues of 14.5 dpc mice. {ECO:0000269|PubMed:16278047}.
Protein families：