NKG2D_MOUSE   O54709


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O54709

Recommended name:NKG2-D type II integral membrane protein

EC number:

Alternative names:(Killer cell lectin-like receptor subfamily K member 1) (NK cell receptor D) (NKG2-D-activating NK receptor) (CD antigen CD314)

Cleaved into:

GeneID:27007

Gene names  (primary ):Klrk1

Gene names  (synonym ):Nkg2d

Gene names  (ORF ):

Length:232

Mass:26710

Sequence:MALIRDRKSHHSEMSKCHNYDLKPAKWDTSQEQQKQRLALTTSQPGENGIIRGRYPIEKLKISPMFVVRVLAIALAIRFTLNTLMWLAIFKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV

Tissue specificity:Expressed in natural killer (NK) cells, activated CD8(+) alpha-beta and gamma-delta T-cells and natural killer T (NKT) cells (at protein level). May be expressed on dendritic cell (DC). Isoform 1 is strongly expressed in natural killer (NK) cells. Isoform 2 is weakly expressed in natural killer (NK) cells. Isoform 1 and isoform 2 are expressed in stimulated, but not in unstimulated, CD8(+) T-cells and macrophages. {ECO:0000269|PubMed:11248803, ECO:0000269|PubMed:11567106, ECO:0000269|PubMed:12150888, ECO:0000269|PubMed:15048723}.

Induction:Up-regulated in activated CD8(+) T-cells. Up-regulated upon lipopolysaccharide (LPS) and interferon treatments in macrophages. Up-regulated in CD8(+) T-cell infiltring pancreatic islets of prediabetic nonobese diabetic (NOD) mice (at protein level). Isoform 1 and isoform 2 are up-regulated upon T-cell receptor (TCR) stimulation in CD8(+) T-cells. Isoform 1 is modestly up-regulated upon lipopolysaccharide (LPS) in macrophages. Isoform 2 is up-regulated upon lipopolysaccharide (LPS) in macrophages. Isoform 2 is up-regulated upon poly(I:C) and interleukin IL2 in natural killer (NK) cells. {ECO:0000269|PubMed:12150888, ECO:0000269|PubMed:15189740}.

Developmental stage:Expressed in NK cells from the thymus at 15 dpc (at protein level). {ECO:0000269|PubMed:12150888}.

Protein families:


   💬 WhatsApp