DPEP3_MOUSE   Q9DA79


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DA79

Recommended name:Dipeptidase 3

EC number:EC 3.4.13.19

Alternative names:(Membrane-bound dipeptidase 3) (MBD-3) (Protein expressed in male leptotene and zygotene spermatocytes 136) (MLZ-136)

Cleaved into:

GeneID:71854

Gene names  (primary ):Dpep3

Gene names  (synonym ):Mbd3

Gene names  (ORF ):

Length:493

Mass:54247

Sequence:MQPAGLEGPRALGLRPLGHRLSLLGVLLLVPSLWVTCTLTTPSPSSAPTTPEASNATTAPGIPNDTATSGVTSDPRLREQALALMRDFPLVDGHNDLPLLLRELFQNQLQDVNLRNFTRGQTNLDRLRDGLVGAQFWSAYIPCQTQDRDAVRLALEQIDLIRRMCSAYPELELVTSADGLNNTQKLACLIGVEGGHSLDTSLAVLRSFYELGVRYLTLTFTCSTPWAESATKFRHHFYTNISGLTSFGEKVVEEMNRLGMMIDLSHASDTLVKQTLEVSQAPVIFSHSAARSVCDNLLNIPDDILQLLKKNGGIVMVTLSMGVLQCSLFANVSTVADHFDHIRTVIGSEFIGIGGSYDGSGRFPQGLEDVSTYPVLIEELLSRGWDERELQGVLRGNLLRVFRQVEQVREKSLGQSPVEVKFPERQQSNTCHSHLLPQPQEDQHQDTHLKVTKLPNILQRASKAPPHPLPGLMATLTSLALILWLCCSGHRAV

Tissue specificity:Expressed in testis but not ovary. {ECO:0000269|PubMed:12738806, ECO:0000269|PubMed:20339383}.

Induction:

Developmental stage:Expressed in ovary and testis at 15.5 dpc. {ECO:0000269|PubMed:20339383}.

Protein families:Metallo-dependent hydrolases superfamily, Peptidase M19 family


   💬 WhatsApp