SYCE2_MOUSE   Q505B8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q505B8

Recommended name:Synaptonemal complex central element protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:71846

Gene names  (primary ):Syce2

Gene names  (synonym ):

Gene names  (ORF ):

Length:171

Mass:19558

Sequence:MERHGVAAPPVELKDQEPPAIVESGEHRQSENHEETPGSVAPSASCQLPGPFSSLDSSIETLKKKAQELIENINESRQKDHALMTNFRDSLKMKVSDLTEKLEERMYQVYSHHSKIIQERLQEFTQKMAKINHLEMELKQVCQTVETVYKDLCVQSEVPTCEEQNYKDGEC

Tissue specificity:Meiotic cells (at protein level). Expressed in the ovary and testis. {ECO:0000269|PubMed:15944401}.

Induction:

Developmental stage:Expressed in ovary, embryo, spleen, thymus, brain, kidney, epididymis, heart and liver at 14 dpc and in oocytes at 18 dpc. {ECO:0000269|PubMed:15944401}.

Protein families:SYCE family


   💬 WhatsApp