TEST_MOUSE   Q9JHJ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHJ7

Recommended name:Testisin

EC number:EC 3.4.21.-

Alternative names:(Serine protease 21) (Tryptase 4)

Cleaved into:

GeneID:57256

Gene names  (primary ):Prss21

Gene names  (synonym ):

Gene names  (ORF ):

Length:324

Mass:36175

Sequence:MGARGKTLVPLLVVVATAAMALQSTYLQVDPEKPELQEPDLLSGPCGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKYSEQYPNDIALLKLSSPVTYNNFIQPICLLNSTYKFENRTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMVCAGTPEGGKDACFGDSGGPLACDQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWIQSTMIRNGLLRPDPVPLLLFLTLAWASSLLRPA

Tissue specificity:Testis.

Induction:

Developmental stage:Expressed in post-meiotic testicular germ cells.

Protein families:Peptidase S1 family


   💬 WhatsApp