MMP19_MOUSE   Q9JHI0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHI0

Recommended name:Matrix metalloproteinase-19

EC number:EC 3.4.24.-

Alternative names:(MMP-19) (Matrix metalloproteinase RASI)

Cleaved into:

GeneID:58223

Gene names  (primary ):Mmp19

Gene names  (synonym ):Rasi

Gene names  (ORF ):

Length:527

Mass:59122

Sequence:MDWQQLWLAFLLPMTVSGRALGPTEKEAVLDYLLQYGYLQKPLEGADDFRLEDITEALRTFQEASGLPISGQMDDATRARMKQPRCGLEDPFNQKSLKYLLLGHWRKKNLTFRIFNVPSTLSLPRVRAALHQAFKYWSSVAPLTFREVKAGWADIRLSFHGRQSLYCSNTFDGPGKVLAHADIPELGSIHFDKDELWTEGTYQGVNLRIIAAHEVGHALGLGHSRYTQALMAPVYAGYQPFFKLHPDDVAGIQALYGKRSPETRDEEEETEMLTVSPVTAKPGPMPNPCSGEVDAMVLGPRGKTYAFKGDYVWTVTDSGPGPLFQISALWEGLPGNLDAAVYSPRTRRTHFFKGNKVWRYVDFKMSPGFPMKFNRVEPNLDAALYWPVNQKVFLFKGSGYWQWDELARTDLSRYPKPIKELFTGVPDRPSAAMSWQDGQVYFFKGKEYWRLNQQLRVAKGYPRNTTHWMHCGSQTPDTNSSTGDVTPSTTDTVLGTTPSTMGSTLDIPSATDSASLSFSANVTLLGA

Tissue specificity:Highly expressed in the liver. Expressed in the arterial tunica media of large blood vessels.

Induction:

Developmental stage:Expressed in proliferating chondrocytes in the chondroepiphysis during musculoskeletal development.

Protein families:Peptidase M10A family


   💬 WhatsApp