PRR15_MOUSE Q9D1T5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D1T5
Recommended name：Proline-rich protein 15
EC number：
Alternative names：
Cleaved into：
GeneID：78004
Gene names (primary )：Prr15
Gene names (synonym )：G90
Gene names (ORF )：
Length：122
Mass：13655
Sequence：MADSGGSSPWWKSLTRKKSKEVTVGVQPQVRPETGQEPSPPHSDRTSSLPENQHSNILGDPGESLRSDKLCEEKTGNSRRNLKISRSGRFKEKRKMRATLLPEGDKSPEEADFPDDPQEDKQ
Tissue specificity：Exhibits a cell type specific expression pattern only in the small and large intestine and in the testis. Along the intestinal tract expression is restricted to the non-proliferating epithelial cells surrounding the villi and no expression is found in the intestinal crypts, where proliferation occurs. In the testis, it is detected only in post-mitotic secondary spermatocytes. {ECO:0000269|PubMed:12768423}.
Induction：
Developmental stage：Expressed in specific structures of the developing head, namely the brain, inner and middle ear, olfactory epithelium, vomeronasal organ, nasopharynx, oropharynx, papillae of the tongue and oral cavity, pituitary gland and epiglottis. {ECO:0000269|PubMed:12768423}.
Protein families：PRR15 family