LYAR_MOUSE   Q08288


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q08288

Recommended name:Cell growth-regulating nucleolar protein

EC number:

Alternative names:(Ly1 antibody-reactive protein) (Protein expressed in male leptotene and zygotene spermatocytes 264) (MLZ-264)

Cleaved into:

GeneID:17089

Gene names  (primary ):Lyar

Gene names  (synonym ):

Gene names  (ORF ):

Length:388

Mass:43736

Sequence:MVFFTCNACGESVKKIQVEKHVSNCRNCECLSCIDCGKDFWGDDYKSHVKCISEGQKYGGKGYEAKTHKGDAKQQAWIQKINELIKKPNVSPKVRELLQQISAFDNVPRKKAKFQNWMKNSLKVHSDSVLEQVWDIFSEASSSEQDQQQPPSHTAKPHAEMPITKVPSAKTNGTTEEQTEAKKNKRERKEERQKNRKKEKKELKLENHQENLRGQKPKKRKKNQEAGHEAAGEEAAEASGPPEKKKAQGGQASEEGADRNGGPGEDAAEGQTKTAAGKRKRPKHSGAESGYKKKKMKLPEQPEEGEAKDHEAPSKGKFNWKGTIKAVLKQAPDNEISVKKLKKKVIAQYHAVMNDHHTSEEELLAIFNRKISRNPTFKVLKDRVKLLK

Tissue specificity:Predominantly expressed in testis, in germ cells, and at a moderate level in spleen, liver and lung (at protein level) (PubMed:19489080, PubMed:23212345, PubMed:24990247). Very high levels in spermatogonia, spermatocytes and round spermatids, but not in testicular sperm and mature sperm (at protein level) (PubMed:20339383, PubMed:23212345, PubMed:24990247). Expressed in ovary (PubMed:20339383). Expressed in the retina, including in photoreceptor outer segments (at protein level) (PubMed:25735755). Expressed in undifferentiated embryonic stem cells (PubMed:19489080, PubMed:23212345). {ECO:0000269|PubMed:19489080, ECO:0000269|PubMed:20339383, ECO:0000269|PubMed:23212345, ECO:0000269|PubMed:24990247, ECO:0000269|PubMed:25735755}.

Induction:

Developmental stage:Expressed in testis and ovary at 15.5 dpc (PubMed:20339383). May be differentially expressed during spermatogenesis. Detected first at P12, the early stage of spermatogenesis. Levels considerably increase at P16, corresponding to the development of pachytene spermatocytes (PubMed:23212345). {ECO:0000269|PubMed:20339383, ECO:0000269|PubMed:23212345}.

Protein families:


   💬 WhatsApp