CRUM3_MOUSE Q8QZT4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8QZT4
Recommended name：Protein crumbs homolog 3
EC number：
Alternative names：
Cleaved into：
GeneID：224912
Gene names (primary )：Crb3
Gene names (synonym )：
Gene names (ORF )：
Length：113
Mass：11921
Sequence：MATPGLGVLLAFGLPMLPSGWSLTAPDPFTNSTTQPPGDESNGGLSSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSEEQVGARAPPPPNLKLPPEERLI
Tissue specificity：Expressed in the apical renal tubules (at protein level). {ECO:0000269|PubMed:17920587}.
Induction：
Developmental stage：Expressed in the branchial arches, optic vesicle and mesonephric tubules of the kidney at 10.5 dpc (PubMed:17920587). Expressed in the internal endodermal layer and in the nascent bronchial tips of the lung at 11.5 dpc (PubMed:17920587). {ECO:0000269|PubMed:17920587}.
Protein families：