CIB2_MOUSE Q9Z309
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z309
Recommended name：Calcium and integrin-binding family member 2
EC number：
Alternative names：(Kinase-interacting protein 2) (KIP 2)
Cleaved into：
GeneID：56506
Gene names (primary )：Cib2
Gene names (synonym )：Kip2
Gene names (ORF )：
Length：187
Mass：21704
Sequence：MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHARFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLEMTLARLTKSELEEDEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI
Tissue specificity：Expressed in the supporting cells in both the organ of Corti and the vestibular sensory epithelia. Expressed in inner and outer segments of photoreceptor cells, as well as in the pigmented epithelium. Also observed in the inner and outer plexiform layers and in the ganglion cell layer (at protein level) (PubMed:23023331). Widely expressed (PubMed:23023331). Strongly expressed in skeletal muscles, brain, kidney and liver (PubMed:23023331). Also expressed in the skeletal muscle, retina and cochlea (PubMed:18611855, PubMed:23023331). Expressed in megakaryocytes and endothelial cells (PubMed:18989529). {ECO:0000269|PubMed:18611855, ECO:0000269|PubMed:18989529, ECO:0000269|PubMed:23023331}.
Induction：
Developmental stage：Expressed in the central nervous system and in muscle at 16 dpc, onward (PubMed:18611855). Expressed in the inner ear and retina at 15.5 and 17.5 dpc (PubMed:23023331). {ECO:0000269|PubMed:18611855, ECO:0000269|PubMed:23023331}.
Protein families：