KAD4_MOUSE Q9WUR9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUR9
Recommended name：Adenylate kinase 4, mitochondrial
EC number：EC 2.7.4.10
Alternative names：(AK 4) (Adenylate kinase 3-like) (Adenylate kinase isoenzyme 4) (GTP:AMP phosphotransferase AK4)
Cleaved into：
GeneID：11639
Gene names (primary )：Ak4
Gene names (synonym )：Ak-4 Ak3b Ak3l1
Gene names (ORF )：
Length：223
Mass：25062
Sequence：MASKLLRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQSKEAY
Tissue specificity：Expressed in kidney, liver, stomach, brain, spinal cord, heart, ovary, oviduct, colon, jejunum, ileum and testis (at protein level) (PubMed:19492028, PubMed:19130895). In the brain, expressed in the pyramidal cells of the cerebrum and glial cells in the cerebellum (at protein level) (PubMed:19492028). In the heart, expressed by myocytes (at protein level) (PubMed:19492028). In the kidney, expressed in the proximal to distal tubule in the cortex and the outer and inner zones of the medulla (at protein level) (PubMed:19492028). In the stomach, expressed in stratified squamous epithelia in the forestomach and in the gastric pit and mucus producing cells of the glandular stomach (at protein level) (PubMed:19492028). Expressed in epithelial cells of the jejunum, ileum, and colon (at protein level) (PubMed:19492028). In the testis, expressed by spermatocytes (at protein level) (PubMed:19492028). In the ovaries, expressed by oocytes, follicular epithelial cells, and corpus luteum cells (at protein level) (PubMed:19492028). In the oviduct, expressed in the epithelia of the isthmus and the ciliated cells of the ampulla (at protein level) (PubMed:19492028). Expressed in the pyramidal cells in the hippocampus (PubMed:9813319). {ECO:0000269|PubMed:19130895, ECO:0000269|PubMed:19492028, ECO:0000269|PubMed:9813319}.
Induction：
Developmental stage：Expressed in the central nervous system in a region-specific manner from the middle stage of embryogenesis to the adulthood in the rodent. {ECO:0000269|PubMed:9813319}.
Protein families：Adenylate kinase family, AK3 subfamily