SHSA7_MOUSE   Q8C3Q5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C3Q5

Recommended name:Protein shisa-7

EC number:

Alternative names:(Cystine-knot AMPAR modulating protein of 59 kDa) (CKAMP59) (GABA(A) receptor auxiliary subunit Shisa7) (Shisa family member 7)

Cleaved into:

GeneID:232813

Gene names  (primary ):Shisa7

Gene names  (synonym ):

Gene names  (ORF ):

Length:558

Mass:58334

Sequence:MPALLLLGTVALLASAAGPAGARPSNDTSSVAPGPLPALLAHLRRLTGALAGGGSAAGTSANATKTSPASGTGAAARAPPPAELCHGYYDVMGQYDATFNCSTGSYRFCCGTCHYRFCCEHRHMRLAQASCSNYDTPRWATTPPPLAGGAGGAGGAGGGPGPGQAGWLEGGRAGGAGGRGGEGPGGSTAYVVCGVISFALAVGVGAKVAFSKASRAPRAHREINVPRALVDILRHQAGPATRPDRARSSSLTPGLGGPDSMAPRTPKNLYNTMKPSNLDNLHYNVNSPKHHAATLDWRAMPPPSPSLHYSTLSCSRSFHNLSHLPPSYEAAVKSELNRYSSLKRLAEKDLDEAYLKRRQLEMPRGTLPLHALRRPGTGGGYRMDGWGGPEELGLAPAPNPRRVMSQEHLLGDGSRASRYEFTLPRARLVSQEHLLLSSPEALRQSREHLLSPPRSPALPPDPTTRASLAASHSNLLLGPGGPPTPLHGLPPSGLHAHHHHALHGSPQPAWMSDAGGGGGTLARRPPFQRQGTLEQLQFIPGHHLPQHLRTASKNEVTV

Tissue specificity:Mainly expressed in neurons (PubMed:26623514, PubMed:29199957, PubMed:31601770). Highly expressed in brain structures including cortex, striatum, olfactory bulb, amygdala hippocampus CA1-3 and dentate gyrus (at protein level) (PubMed:26623514, PubMed:29199957, PubMed:31601770). {ECO:0000269|PubMed:26623514, ECO:0000269|PubMed:29199957, ECO:0000269|PubMed:31601770}.

Induction:

Developmental stage:Expressed in the cerebral cortex on 17 dpc and in olfactory bulb and hippocampus on postnatal day 1 (P1) (PubMed:26623514). Expression in hippocampus increases during postnatal development and reaches a plateau after 3 weeks (PubMed:29199957). Expression is high during prenatal development and decreases in the thalamus and brainstem during postnatal development (PubMed:26623514). {ECO:0000269|PubMed:26623514, ECO:0000269|PubMed:29199957}.

Protein families:Shisa family


   💬 WhatsApp