TPPP3_MOUSE Q9CRB6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CRB6
Recommended name：Tubulin polymerization-promoting protein family member 3
EC number：
Alternative names：
Cleaved into：
GeneID：67971
Gene names (primary )：Tppp3
Gene names (synonym )：
Gene names (ORF )：
Length：176
Mass：18965
Sequence：MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFSKVKAKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLIAGKEPANIGVTKAKTGGAVDRLTDTSKYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Tissue specificity：
Induction：Up-regulated by estradiol. {ECO:0000269|PubMed:29901777}.
Developmental stage：Expressed in the connective tissues of differentiating tendons and synovial joints (PubMed:19235716). Expressed in the uterus during window of implantation and early pregnancy (at protein level) (PubMed:29901777). {ECO:0000269|PubMed:19235716, ECO:0000269|PubMed:29901777}.
Protein families：TPPP family