F107B_MOUSE Q3TGF2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TGF2
Recommended name：Protein FAM107B
EC number：
Alternative names：
Cleaved into：
GeneID：66540
Gene names (primary )：Fam107b
Gene names (synonym )：
Gene names (ORF )：
Length：131
Mass：15572
Sequence：MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES
Tissue specificity：Expressed in the hippocampus and hypothalamus. Expressed in the pontine nuclei and reticulotegmental nucleus. Expressed in Purkinje cell and nuclear layers of the cerebelum. Expressed in the choroid plexus. Expressed in hippocampal granule neurons of the dente gyrus. {ECO:0000269|PubMed:25637808}.
Induction：Is not up-regulated in the hippocampus by acute social defeat stress or glucocorticoids stimulation. {ECO:0000269|PubMed:25637808}.
Developmental stage：Expressed in the developing brain embryo. Expressed in the mesencephalon in the tectum at 12.5 dpc and in the inferior colliculus at 16.5 dpc until birth. Expressed in the telencephalon in the ventricular zone, cortical plate, ganglionic eminence and hippocampus from 14.5 to 18.5 dpc. Expressed in the rhombencephalon in the pontine nuclei and in the external granule layer of the cerebellum at 16.5 and 18.5 dpc. {ECO:0000269|PubMed:25637808}.
Protein families：FAM107 family