KREM1_MOUSE Q99N43
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99N43
Recommended name:Kremen protein 1
EC number:
Alternative names:(Dickkopf receptor) (Kringle domain-containing transmembrane protein 1) (Kringle-containing protein marking the eye and the nose)
Cleaved into:
GeneID:84035
Gene names (primary ):Kremen1
Gene names (synonym ):Kremen
Gene names (ORF ):
Length:473
Mass:51673
Sequence:MAPPAARLALLSAAALTLAARPAPGPRSGPECFTANGADYRGTQSWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKHGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMAAVVYSPDFPDTYATGRVCYWTIRVPGASRIHFNFTLFDIRDSADMVELLDGYTHRVLVRLSGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQATKEEPPQERPAVNQTLAEVITEQANLSVSAAHSSKVLYVITPSPSHPPQTAPGSHSWAPSVGANSHRVEGWTVYGLATLLILTVTAVVAKILLHVTFKSHRVPASGDLRDCRQPGASGDIWTIFYEPSTTISIFKKKLKGQSQQDDRNPLVSD
Tissue specificity:In the adult, widely expressed with high levels in heart, lung, kidney, skeletal muscle and testis. {ECO:0000269|PubMed:11267660}.
Induction:
Developmental stage:Expressed in the developing cochlea. Expressed first in the prosensory domain and the expression is restricted to supporting cells as development proceeds (at protein level). In the embryo, expression is first detected on day 9 and increases up to day 18. Lower levels are found in adult. At 9.5 dpc, expression is localised to the apical ectodermal ridge (AER) of the developing fore- and hindlimb buds, the telencephalon and the first brachial arch. At 10.5 dpc, expression is also observed in the myotome and in sensory tissues such as the nasal pit and optic vesicle. Expressed in the developing brain and developing limb buds. {ECO:0000269|PubMed:11267660, ECO:0000269|PubMed:18505822, ECO:0000269|PubMed:26206087, ECO:0000269|PubMed:27550540}.
Protein families: