TLE5_MOUSE P63002
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63002
Recommended name：TLE family member 5
EC number：
Alternative names：(Amino-terminal enhancer of split) (Amino enhancer of split) (Grg-5) (Groucho-related protein 5) (Protein ESP1) (Protein GRG)
Cleaved into：
GeneID：14797
Gene names (primary )：Tle5
Gene names (synonym )：Aes Esp1 Grg Grg5
Gene names (ORF )：
Length：197
Mass：22000
Sequence：MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQTHLSKEDKNGHDGDTHQEDDGEKSD
Tissue specificity：Ubiquitously expressed in developing embryos by midgestation, a wide expression is conserved in adult. In mouse, abundantly expressed in muscle, heart and brain. {ECO:0000269|PubMed:8369224}.
Induction：
Developmental stage：Expressed in the developing eye and forebrain of embryos. {ECO:0000269|PubMed:12050133}.
Protein families：WD repeat Groucho/TLE family