CK097_MOUSE Q9DAE7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DAE7
Recommended name：Uncharacterized protein C11orf97 homolog
EC number：
Alternative names：
Cleaved into：
GeneID：69325
Gene names (primary )：
Gene names (synonym )：
Gene names (ORF )：
Length：121
Mass：13565
Sequence：MRRQEALAGTASEAGREGEQPRPAGLGCRTRAEPGGPQESRQQWKTFLYCEPHKRIKEVLEEELSIKRDECHVKSPPTVALDGIWSIRRNLPVGGTISGQQSRNSSLPQAKYYSRHGGLRR
Tissue specificity：Predominantly expressed in tissues containing motile cilia (PubMed:28666954, PubMed:27914912). Also expressed in non-motile ciliated adult olfactory bulbs (PubMed:28666954). {ECO:0000269|PubMed:27914912, ECO:0000269|PubMed:28666954}.
Induction：Expression is activated by FOXJ1 and NOTO. {ECO:0000269|PubMed:27914912, ECO:0000269|PubMed:28666954}.
Developmental stage：Expressed in the developing fetal lung epithelium, embryonic ventral node and developing brain (at protein level) (PubMed:28666954, PubMed:27914912). {ECO:0000269|PubMed:27914912, ECO:0000269|PubMed:28666954}.
Protein families：