HXD10_MOUSE P28359
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28359
Recommended name：Homeobox protein Hox-D10
EC number：
Alternative names：(Homeobox protein Hox-4.5) (Homeobox protein Hox-5.3)
Cleaved into：
GeneID：15430
Gene names (primary )：Hoxd10
Gene names (synonym )：Hox-4.5 Hoxd-10
Gene names (ORF )：
Length：340
Mass：38328
Sequence：MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNESASGQEPTKVSQVESPEAKGGLPEDRSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
Tissue specificity：
Induction：
Developmental stage：Expressed in the developing limb buds. Expressed in the posterior-most regions of the fetus. Strongly expressed in 12.5 day old fetuses in both spinal cord and pre-vertebral column with an anterior boundary of expression lying at the level of the second or third lumbar pre-vertebrae. {ECO:0000269|PubMed:2569969}.
Protein families：Abd-B homeobox family