TFEC_MOUSE Q9WTW4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTW4
Recommended name：Transcription factor EC
EC number：
Alternative names：(TFE-C) (mTFEC)
Cleaved into：
GeneID：21426
Gene names (primary )：Tfec
Gene names (synonym )：Tcfec
Gene names (ORF )：
Length：317
Mass：35144
Sequence：MTFDCRVCDQTLKRAQPPAASCMPLAEHEPMSPDSDAGCAGNPFTNLLALGKKDGAEKWHLSGSILDVYSDEQGISSANAGLTDAPCPSILPMRKEIAETDGRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVDYIKWLQKEQQRARELEHRQKKLEHANRQLRLRIQELEIQARAHGLPILASLGTADVGTHITKQQTHPERNLGGCCLQLTPTQGTSPEFYEQAVAFSDPLSHFTDLSFSAALKEEQRLDGMLLSDTICPFGTDPLLSAISPAVSKASSRSSLSSEDGDEL
Tissue specificity：Expressed in osteoclast-like cells (at protein level). Expressed in cells of the mononuclear phagocyte lineage. Expressed in macrophages and in osteoclast-like cells. {ECO:0000269|PubMed:9973413}.
Induction：Up-regulated in bone marrow-derived macrophages by Th2 cytokines, IL-4, IL-13 and LPS. {ECO:0000269|PubMed:15908341}.
Developmental stage：Expressed in the early developing retinal pigmented epithelium and in the peripheral retina. {ECO:0000269|PubMed:15459106}.
Protein families：MiT/TFE family