TX19B_MOUSE Q9D5S1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D5S1
Recommended name：Testis-expressed protein 19.2
EC number：
Alternative names：(Testis-expressed protein 19B)
Cleaved into：
GeneID：70956
Gene names (primary )：Tex19.2
Gene names (synonym )：Tex19b
Gene names (ORF )：
Length：317
Mass：35235
Sequence：MCPPVSVRHGAKGMSCLYGAWLYHLVHGEQMKICFACFKAAFLVVKNMLEMGDWEEGVWDAEPMELSEASSEPEEWPGLSGGEGQGHLPHGISVSAGSGAQGPQPVPTELGPQEAVPLDLGPEDAEWTQALPWRFDGLSPCSHWLIPPLSWWEIFNVSPSPGQPVLLELSPTWPMDPLEAEAWLVGLKFVFLLGGFDAICYMLSMTPCWAVRTRVQRWQVLLDPGDVRVAQLQNAPEQQDLHRWKLSVLESSELGMELVPADCSLQKGGFKVHSYLPWHNSTPESWSREPGERLLVVEVVSLRELPCFRSPSPDPHN
Tissue specificity：Specifically expressed in somatic cells of male gonad lineage. {ECO:0000269|PubMed:18096721, ECO:0000269|PubMed:28254886}.
Induction：
Developmental stage：Expressed in the ectoderm and then in primordial germ cells (PGCs). Expressed in testis from embryos (13.5 dpc) to adulthood in gonocytes and spermatocytes. {ECO:0000269|PubMed:22447323}.
Protein families：