DKKL1_MOUSE Q9QZL9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZL9
Recommended name：Dickkopf-like protein 1
EC number：
Alternative names：(Protein soggy-1) (SGY-1)
Cleaved into：
GeneID：50722
Gene names (primary )：Dkkl1
Gene names (synonym )：Sgy1
Gene names (ORF )：
Length：230
Mass：26639
Sequence：MCRLRVLLLLLPLAFVSSSALPIHDVDSQQNTSGFLGLQRLLQSFSRLFLKNDLLRDLDNFFSSPMDFRDLPRNFHQEENQEHRMGNHTLSSHLQIDKVTDNQTGEVLISEKVEASIEPERNPEGDWKVPKVEAKEPPVPVQKVTDSLHPEPRQVAFWIMKMPRRRTQPDVQDGGRWLIEKRHRMQAIRDGLRGGAREDSLEDGVHIPQHAKLPVRKTHFLYILRPSQQL
Tissue specificity：Testis-specific. Abundant in the seminiferous tubules where it is associated with developing spermatocytes. Expressed only in testis (at protein level) (PubMed:15892050, PubMed:19596310). Not detectable on postnatal days 4 and 9 but after day 18 it gradually increased as the development of testes progressed. Expressed at high levels in testis and at weak levels in epididymis (PubMed:22817830). {ECO:0000269|PubMed:11024178, ECO:0000269|PubMed:15892050, ECO:0000269|PubMed:19596310, ECO:0000269|PubMed:22817830}.
Induction：
Developmental stage：Expressed in the embryo only after day 15. In the adult, expressed only in developing spermatocytes. Expressed in the developing cochlea. Detected only in developing spermatocytes and spermatids in seminiferous tubules. Moreover, first appears specifically in zygotene/pachytene spermatocytes. Found in puddles in the pachytene spermatocytes of all stage tubules and then in crescent shaped structures characteristic of acrosomes in early step spermatids. Detected in mature sperm (PubMed:15892050). Expressed strongly in trophoblast stem cells and further up-regulated in trophoblast giant cells. Expression is maintained in post-implantation placental tissues in utero. Highly expressed from 7.5 dpc trophectoderm to 12.5 dpc placenta. Expression remains baseline in postimplantation embryonic tissues (PubMed:19596312). {ECO:0000269|PubMed:11024178, ECO:0000269|PubMed:15892050, ECO:0000269|PubMed:19596312, ECO:0000269|PubMed:27550540}.
Protein families：