PITX2_MOUSE P97474
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97474
Recommended name：Pituitary homeobox 2
EC number：
Alternative names：(ALL1-responsive protein ARP1) (BRX1 homeoprotein) (Homeobox protein PITX2) (Orthodenticle-like homeobox 2) (Paired-like homeodomain transcription factor 2) (Paired-like homeodomain transcription factor Munc 30) (Solurshin)
Cleaved into：
GeneID：18741
Gene names (primary )：Pitx2
Gene names (synonym )：Arp1 Brx1 Otlx2 Ptx2 Rgs
Gene names (ORF )：
Length：317
Mass：35321
Sequence：METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPKSRKESASSKLFPRQHPGANEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
Tissue specificity：In day-11 embryos, expressed in the periocular mesenchyme, maxillary and mandibular epithelia, umbilicus, Rathke pouch, vitelline vessels and limb mesenchyme. In adult tissues, expressed in pituitary gland, brain, kidney, eye, lung, testis and tongue.
Induction：
Developmental stage：Expressed in the embryonic heart. Expressed in the left lateral plate mesoderm and symmetrically in the head mesoderm at 8.5 dpc. Isoform Ptx2c is expressed in the ventral outflow tract region (OFT), right ventricle (RV) and in the left atrium of the heart. {ECO:0000269|PubMed:15475956}.
Protein families：Paired homeobox family, Bicoid subfamily