CITE2_MOUSE O35740
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35740
Recommended name：Cbp/p300-interacting transactivator 2
EC number：
Alternative names：(MSG-related protein 1) (MRG-1) (P35srj)
Cleaved into：
GeneID：17684
Gene names (primary )：Cited2
Gene names (synonym )：Mrg1 Msg2
Gene names (ORF )：
Length：269
Mass：28321
Sequence：MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPTAGHQMNGTNQHFRDCNPKHSGGSSTPGGAGGSGTPGGSGGTSGGAGGSSAGGSGGGSTMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:15051727}.
Induction：
Developmental stage：Expressed in the embryonic heart. Expressed in the ventral node, cardiac crescent and blood islands at 7.5 dpc. Expressed in the cardiac crescent, anterior lateral mesoderm and in trunk paraxial mesoderm at 8 dpc. Expressed in forebrain-midbrain boundary, branchial arches 1 and 2, heart and somites at 9.5 dpc (at protein level). Expressed in the coelomic epithelium and in cells in the underlying nephrogenic mesenchyme of the genital ridge at 10 dpc. Expressed in the genital ridge and the presumptive adrenal area at 10.5 dpc. Expressed in the gonad and in the adrenal anlagen at 12 dpc. Expressed in the cells of the adrenal cortex at 14 dpc. Expressed throughout the embryonic heart, as well as in the node and the lateral plate mesoderm (LPM), that are responsible for initiating and maintaining left-right patterning. Expressed in the crown cells of the node. {ECO:0000269|PubMed:15475956, ECO:0000269|PubMed:15750185, ECO:0000269|PubMed:17537799, ECO:0000269|PubMed:19457926}.
Protein families：CITED family