CYS1_MOUSE   Q8R4T1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R4T1

Recommended name:Cystin-1

EC number:

Alternative names:(Cilia-associated protein)

Cleaved into:

GeneID:12879

Gene names  (primary ):Cys1

Gene names  (synonym ):

Gene names  (ORF ):

Length:145

Mass:15506

Sequence:MGSGSSRSGRIPRRRRSPDRRQTGPGETASEGGTADQAPTAAGQEESGRDPRPATPSGGREETLRLLDQLLAESEAWGPQELTPRGPARLAPAVSPEKKVKGNPEDSCASEAPGNSPKRPEGQSAISYDYSEEELMASIEREYCR

Tissue specificity:Expressed primarily in the kidney and liver. Expressed at lower levels in the lung, brain and heart. {ECO:0000269|PubMed:11854326}.

Induction:

Developmental stage:Expressed in the fetal kidney.

Protein families:


   💬 WhatsApp