EFNB1_MOUSE   P52795


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52795

Recommended name:Ephrin-B1

EC number:

Alternative names:(CEK5 receptor ligand) (CEK5-L) (EFL-3) (ELK ligand) (ELK-L) (EPH-related receptor tyrosine kinase ligand 2) (LERK-2) (Stimulated by retinoic acid gene 1 protein)

Cleaved into:Ephrin-B1 C-terminal fragment (Ephrin-B1 CTF); Ephrin-B1 intracellular domain (Ephrin-B1 ICD)

GeneID:13641

Gene names  (primary ):Efnb1

Gene names  (synonym ):Epl2 Eplg2 Lerk2 Stra1

Gene names  (ORF ):

Length:345

Mass:37859

Sequence:MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Tissue specificity:Expressed on lateral floor plate cells, specifically on commissural axon segments that have passed through the floor plate. Expressed in cells of the retinal ganglion cell layer during retinal axon guidance to the optic disk (PubMed:10704386). Expressed in myogenic progenitor cells (PubMed:27446912). {ECO:0000269|PubMed:10704386, ECO:0000269|PubMed:27446912}.

Induction:

Developmental stage:Expressed in the floor plate throughout the period of commissural axon pathfinding (PubMed:10704386). In myogenic progenitor cells, highly expressed during early development (11.5 dpc) and progressively repressed as developments proceeds (PubMed:27446912). {ECO:0000269|PubMed:10704386, ECO:0000269|PubMed:27446912}.

Protein families:Ephrin family


   💬 WhatsApp