YTHD2_MOUSE Q91YT7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91YT7
Recommended name：YTH domain-containing family protein 2
EC number：
Alternative names：
Cleaved into：
GeneID：213541
Gene names (primary )：Ythdf2
Gene names (synonym )：
Gene names (ORF )：
Length：579
Mass：62280
Sequence：MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASSVPKVVGSAVGSGSITSNIVASSSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Tissue specificity：Widely expressed, with highest expression in testis. {ECO:0000269|PubMed:28867294}.
Induction：
Developmental stage：Expressed in the germline during gametogenesis: expressed at all stages of spermatogenesis, with elevated expression observed in pachytene spermatocytes (PubMed:28867294). During oogenesis, expressed at all stages of folliculogenesis: expressed both in the oocyte and in somatic granulosa cells (PubMed:28867294). Also expressed during oocyte maturation, with abundant expression in germinal vesicle as well as in meiosis II oocytes (PubMed:28867294). {ECO:0000269|PubMed:28867294}.
Protein families：YTHDF2 family